missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human KCNMB1 Partial ORF (AAH25707, 39 a.a. - 130 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00003779-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the product of this gene, the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits. [provided by RefSeq]
Sequence: LPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQVLNWRDGDTSLYPCQVCEPVPNCPCPRGSpecifications
| AAH25707 | |
| Liquid | |
| 3779 | |
| KCNMB1 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| K(VCA)beta/SLO-BETA/hslo-beta | |
| KCNMB1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.75kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| LPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQVLNWRDGDTSLYPCQVCEPVPNCPCPRG | |
| RUO | |
| KCNMB1 | |
| Wheat Germ (in vitro) | |
| GST |