missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IMPA2 Full-length ORF (NP_055029.1, 1 a.a. - 288 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00003613-P01.10ug

Detalles adicionales : Weight : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16140135

  • 2665.00 DKK / 10µg
Estimated Shipment: 23-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Descripción

Descripción

Sequence: MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK
Especificaciones

Especificaciones

NP_055029.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
57.7kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
IMPA2
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, Protein Array, ELISA, Western Blot
3613
IMPA2 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK
RUO
IMPA2
Recombinant
wheat germ expression system
Recomendaciones

Recomendaciones

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales