missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human IGF1 Partial ORF (NP_000609, 49 a.a. - 138 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00003479-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Several transcript variants encoding different isoforms have been found for this gene
Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSRDLRRLEMYCAPLKPTKSARSVRAQRHTDMPKTQKEVHLSpecifications
| NP_000609 | |
| Liquid | |
| 3479 | |
| IGF1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| IGFI | |
| IGF1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.64kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSRDLRRLEMYCAPLKPTKSARSVRAQRHTDMPKTQKEVHL | |
| RUO | |
| IGF1 | |
| Wheat Germ (in vitro) | |
| GST |