missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human IER3 Partial ORF (NP_003888.1, 1 a.a. - 85 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00008870-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene functions in the protection of cells from Fas- or tumor necrosis factor type alpha-induced apoptosis. Partially degraded and unspliced transcripts are found after virus infection in vitro, but these transcripts are not found in vivo and do not generate a valid protein. [provided by RefSeq]
Sequence: MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRVVRRQLPVEEPNPAKRSpecifications
| NP_003888.1 | |
| Liquid | |
| 8870 | |
| IER3 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DIF-2/DIF2/GLY96/IEX-1/IEX-1L/IEX1/PRG1 | |
| IER3 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.09kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRVVRRQLPVEEPNPAKR | |
| RUO | |
| IER3 | |
| Wheat Germ (in vitro) | |
| GST |