missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HNF1B Partial ORF (NP_000449.1, 29 a.a. - 118 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006928-Q03.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16074825

  • 2665.00 DKK / 10µg
Estimated Shipment: 15-08-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of the homeodomain-containing superfamily of transcription factors. The protein binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. The gene has been shown to function in nephron development, and regulates development of the embryonic pancreas. Mutations in this gene result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of this gene is altered in some types of cancer. Multiple transcript variants encoding different isoforms have been found for this gene

Sequence: ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDP
Specifications

Specifications

NP_000449.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.53kDa
12.5% SDS-PAGE Stained with Coomassie Blue
ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDP
RUO
HNF1B
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
6928
HNF1B (Human) Recombinant Protein (Q03)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FJHN/HNF1beta/HNF2/HPC11/LF-B3/LFB3/MODY5/TCF2/VHNF1
HNF1B
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers