Learn More
Abnova™ Human HMGCS2 Partial ORF (NP_005509.1, 424 a.a. - 508 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00003158-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Mitochondrial 3-hydroxy-3-methylglutaryl CoA synthase (HMGCS2; EC 2.3.3.10) mediates the first reaction of ketogenesis, a metabolic pathway that provides lipid-derived energy for brain, heart, kidney, and other organs during times of carbohydrate deprivation such as fasting (Robinson and Williamson, 1980 [PubMed 6986618]). Also see cytoplasmic HMG-CoA synthase (HMGCS1; MIM 142940), which mediates an early step in cholesterol synthesis.[supplied by OMIM]
Sequence: RVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKYARRPVSpecifications
NP_005509.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.09kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
RVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKYARRPV | |
RUO | |
HMGCS2 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
3158 | |
HMGCS2 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
HMGCS2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |