missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human HLA-DPB1 Control Fragment Recombinant Protein

Artikelnummer. 30209235
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30209235

Brand: Invitrogen™ RP90436

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82411 (PA5-82411. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer P04440
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 3115
Navn Human HLA-DPB1 Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias beta1 domain MHC class II HLA DPB; CD; CELIAC1; class II HLA beta chain; DC-1 alpha chain; DC-alpha; DPB1; DQ-A1; GSE; histocompatibility antigen HLA-DR alpha; HLA class II histocompatibility antigen, DP beta 1 chain; HLA class II histocompatibility antigen, DP(W4) beta chain; HLA class II histocompatibility antigen, DQ alpha 1 chain; HLA class II histocompatibility antigen, DQ(W3) alpha chain; HLA class II histocompatibility antigen, DR alpha chain; HLA DP14-beta chain; HLA-DCA; HLA-DP; HLA-DP histocompatibility type, beta-1 subunit; HLA-DP1B; HLA-DPB; HLA-DPB1; HLA-DQA; HLA-DQA1; HLA-DRA; HLA-DRA1; leucocyte antigen DQA1; leukocyte antigen alpha chain; major histocompatibility complex class II antigen beta chain; major histocompatibility complex, class II, DP beta 1; major histocompatibility complex, class II, DQ alpha 1; major histocompatibility complex, class II, DR alpha; MHC cell surface glycoprotein; MHC cla; MHC class II antigen; MHC class II antigen beta chain; MHC class II antigen DP beta 1 chain; MHC class II antigen DPB1; MHC class II antigen DPbeta1; MHC class II antigen DRA; MHC class II DQA1; MHC class II HLA-D alpha glycoprotein; MHC class II HLA-DP-beta-1; MHC class II HLA-DQ-alpha-1; MHC class II HLA-DRB1; MHC class II surface glycoprotein; MHC HLA DPB1; MHC HLA-DQ alpha; MLRW
Fælles navn HLA-DPB1
Gen symbol HLA-DPB1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens YNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTF
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.