missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human HLA-DPA1 (aa 48-184) Control Fragment Recombinant Protein

Artikelnummer. 30200244
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30200244

Brand: Invitrogen™ RP90437

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53682 (PA5-53682. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer P20036
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 3113
Navn Human HLA-DPA1 (aa 48-184) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias DP(W3); DP(W4); HLA class II histocompatibility antigen, DP alpha 1 chain; HLADP; HLA-DP1A; HLA-DPA1; HLASB; HLA-SB alpha chain; major histocompatibility complex, class II, DP alpha 1; MHC class II antigen; MHC class II DP3-alpha; MHC class II DPA1; MHC class II HLA-DPA1 antigen; PLT1; Primed lymphocyte test-1
Fælles navn HLA-DPA1
Gen symbol HLA-DPA1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens RPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTF
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.