missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human HLA-DOA (aa 25-74) Control Fragment Recombinant Protein

Artikelnummer. 30198670
Klik for at se tilgængelige muligheder
Mængde:
100 μL
This item is not returnable. View return policy

Product Code. 30198670

Brand: Invitrogen™ RP109842

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Reacts with HLA-DO, a heterodimer formed by DNalpha and DObeta subunits in B cells. DNalpha and DObeta are the products of the non-classical class II genes, HLA-DNA and HLA-DOB, respectively. DO forms tight complexes with DM in the endoplasmic reticulum and is thereby sorted to lysosomal vesicles during antigen processing and presentation. It is tightly associated with DM and it is selectively expressed on antigen-presenting cells, such as B cells, dendritic cells and thymic epithelial cells. DO can enhance the efficiency of peptide loading and has been found to stabilize DM at low pH, preserving its chaperon activity. DO-DM complexes are more efficient than DM in protecting empty DR molecules. Reports describe DO as a co-chaperone of DM. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Specifications

Adgangsnummer P06340
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 3111
Navn Human HLA-DOA (aa 25-74) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias HLA class II histocompatibility antigen, DO alpha chain; HLA-D0-alpha; HLA-DNA; HLA-DOA; HLADZ; HLA-DZA; lymphocyte antigen; major histocompatibility complex, class II, DN alpha; major histocompatibility complex, class II, DO alpha; MHC class II antigen DOA; MHC DN-alpha; MHC DZ alpha
Fælles navn HLA-DOA
Gen symbol HLA-DOA
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.