missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HIST1H3E Partial ORF (NP_003523, 69 a.a. - 125 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00008353-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq]
Sequence: QRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDISpecifications
| NP_003523 | |
| Liquid | |
| 8353 | |
| HIST1H3E (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| H3.1/H3/d/H3FD | |
| HIST1H3E | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.01kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| QRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDI | |
| RUO | |
| HIST1H3E | |
| Wheat Germ (in vitro) | |
| GST |