missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HHIP Partial ORF (NP_071920, 21 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00064399-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16139646

  • 4040.00 DKK / 25µg
Estimated Shipment: 18-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a protein similar to the mouse hedgehog-interacting protein, a regulatory component of the hedgehog signalling pathway. Members of the hedgehog family are evolutionarily conserved proteins which are involved in many fundamental processes in embryonic development, including anteroposterior patterns of limbs and regulation of left-right asymmetry. [provided by RefSeq]

Sequence: GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
Specifications

Specifications

NP_071920
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
RUO
HHIP
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
64399
HHIP (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ20992/FLJ90230/HIP/STQTL12
HHIP
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers