missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. 30212933

Invitrogen™ Human Hemoglobin alpha-1 (aa 1-37) Control Fragment Recombinant Protein

Artikelnummer. 30212933
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30212933

Brand: Invitrogen™ RP104362

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60507 (PA5-60507. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer P69905
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 3039
Navn Human Hemoglobin alpha-1 (aa 1-37) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias alpha one globin; alpha-2 globin chain; Alpha-globin; delta globin; HBA1; HBA2; HBA-T3; HBH; hemoglobin alpha 1 globin chain; Hemoglobin alpha chain; Hemoglobin subunit alpha; hemoglobin subunit alpha 1; hemoglobin, alpha 1
Fælles navn Hemoglobin alpha-1
Gen symbol HBA1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSF
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.