missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HEMK2 Full-length ORF (AAH11554.1, 1 a.a. - 186 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00029104-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16179012

  • 2665.00 DKK / 10µg
Estimated Shipment: 12-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq]

Sequence: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
Specifications

Specifications

AAH11554.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
46.2kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C21orf127/HEMK2/MGC19995/MTQ2/N6AMT/PRED28
N6AMT1
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
29104
HEMK2 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
RUO
N6AMT1
Wheat Germ (in vitro)
GST
Liquid
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers