missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GYPB Partial ORF (NP_002091.2, 22 a.a. - 59 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00002994-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. GYPB gene consists of 5 exons and has 97% sequence homology with GYPA from the 5' UTR to the coding sequence encoding the first 45 amino acids. In addition to the M or N and S or s antigens, that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta; also, Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. [provided by RefSeq]
Sequence: TTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPASpecifications
| NP_002091.2 | |
| Liquid | |
| 2994 | |
| GYPB (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CD235b/GPB/GPB.NY/GYPHe.NY/HGpMiVI/MNS/SS | |
| GYPB | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 29.81kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| TTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPA | |
| RUO | |
| GYPB | |
| Wheat Germ (in vitro) | |
| GST |