Learn More
Abnova™ Human GYPB Partial ORF (NP_002091.2, 22 a.a. - 59 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00002994-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. GYPB gene consists of 5 exons and has 97% sequence homology with GYPA from the 5' UTR to the coding sequence encoding the first 45 amino acids. In addition to the M or N and S or s antigens, that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta; also, Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. [provided by RefSeq]
Sequence: TTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPASpecifications
NP_002091.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
29.81kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
TTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPA | |
RUO | |
GYPB | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
2994 | |
GYPB (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CD235b/GPB/GPB.NY/GYPHe.NY/HGpMiVI/MNS/SS | |
GYPB | |
Recombinant | |
wheat germ expression system |