missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. 30195022

Invitrogen™ Human GPR30 (aa 1-62) Control Fragment Recombinant Protein

Artikelnummer. 30195022
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30195022

Brand: Invitrogen™ RP90872

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum. The protein binds estrogen, resulting in intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. Alternate transcriptional splice variants which encode the same protein have been characterized.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q99527
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 2852
Navn Human GPR30 (aa 1-62) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias 6330420K13Rik; CEPR; Ceprl; chemoattractant receptor-like 2; chemokine receptor-like 2; CMKRL2; constitutively expressed peptide-like receptor; constitutively expressed peptide-like receptor like; DRY12; FEG-1; Flow-induced endothelial G-protein coupled receptor 1; G protein-coupled estrogen receptor 1; G protein-coupled receptor 30; GPCR-Br; GPER; GPER1; Gpr30; GPR41; G-protein coupled estrogen receptor 1; G-protein coupled receptor 30; G-protein coupled receptor 41; heptahelix receptor; IL8-related receptor DRY12; LERGU; LERGU2; leucine rich protein in GPR30 3'UTR; LyGPR; Lymphocyte-derived G-protein coupled receptor; membrane estrogen receptor; mER
Fælles navn GPR30
Gen symbol GPER1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.