missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. 30207245

Invitrogen™ Human GLRX (aa 57-88) Control Fragment Recombinant Protein

Artikelnummer. 30207245
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30207245

Brand: Invitrogen™ RP104818

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65437 (PA5-65437. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutaredoxin (Grx), also known as thiol transferase, is a small heat-stable oxidoreductase. Grxs form part of the glutaredoxin system, comprising NADPH, GSH and glutathione reductase, which transfers electrons from NADPH to glutaredoxins via GSH. First recovered in E.coli as GSH-dependent hydrogen donors for ribonucleotide reductase, Grx catalyzes GSH-disulfide oxidoreductase via two redox-active cysteine residues. The active sequence (Cys-Pro-Tyr-Cys) is conserved in a variety of species. The 12-kDa dithiol protein has a role in reduction of mixed disulfides in cells exposed to oxidative stress.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer P35754
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 2745
Navn Human GLRX (aa 57-88) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias C86710; D13Wsu156e; GLRX; Glrx1; GLRXL; glutaredoxin; glutaredoxin (thioltransferase); glutaredoxin 1; glutaredoxin 1 (thioltransferase); Glutaredoxin1; glutaredoxin-1; Grx; Grx 1; Grx1; MGC117; MGC117407; thiol disulfide oxidoreductase; thioltransferase; Thioltransferase 1; thioltransferase; TTase; Thioltransferase1; Thioltransferase-1; TTase; TTase 1; TTase1; TTase-1; TTF; Unknown (protein for MGC:133817)
Fælles navn GLRX
Gen symbol GLRX
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens IQDYLQQLTGARTVPRVFIGKDCIGGCSDLVS
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.