Learn More
Invitrogen™ Human GLRX (aa 57-88) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP104818
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65437 (PA5-65437. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Glutaredoxin (Grx), also known as thiol transferase, is a small heat-stable oxidoreductase. Grxs form part of the glutaredoxin system, comprising NADPH, GSH and glutathione reductase, which transfers electrons from NADPH to glutaredoxins via GSH. First recovered in E.coli as GSH-dependent hydrogen donors for ribonucleotide reductase, Grx catalyzes GSH-disulfide oxidoreductase via two redox-active cysteine residues. The active sequence (Cys-Pro-Tyr-Cys) is conserved in a variety of species. The 12-kDa dithiol protein has a role in reduction of mixed disulfides in cells exposed to oxidative stress.
Specifications
P35754 | |
Blocking Assay, Control | |
2745 | |
100 ÎĽL | |
C86710; D13Wsu156e; GLRX; Glrx1; GLRXL; glutaredoxin; glutaredoxin (thioltransferase); glutaredoxin 1; glutaredoxin 1 (thioltransferase); Glutaredoxin1; glutaredoxin-1; Grx; Grx 1; Grx1; MGC117; MGC117407; thiol disulfide oxidoreductase; thioltransferase; Thioltransferase 1; thioltransferase; TTase; Thioltransferase1; Thioltransferase-1; TTase; TTase 1; TTase1; TTase-1; TTF; Unknown (protein for MGC:133817) | |
GLRX | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human GLRX (aa 57-88) Control Fragment | |
RUO | |
GLRX | |
Unconjugated | |
Recombinant | |
IQDYLQQLTGARTVPRVFIGKDCIGGCSDLVS | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.