missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GIF Partial ORF (NP_005133.2, 318 a.a. - 417 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

2735.00 DKK - 4145.00 DKK

Specifications

Accession Number	NP_005133.2
For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez)	2694
Molecular Weight (g/mol)	36.74kDa

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16198664 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00002694-Q01.25ug	25 ug	This item is currently unavailable or has been discontinued. View the product page for possible alternatives.		N/A

16188664 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00002694-Q01.10ug	10 ug	This item is currently unavailable or has been discontinued. View the product page for possible alternatives.		N/A

Description

This gene is a member of the cobalamin transport protein family. It encodes a glycoprotein secreted by parietal cells of the gastric mucosa and is required for adequate absorption of vitamin B12. Vitamin B12 is necessary for erythrocyte maturation and mutations in this gene may lead to congenital pernicious anemia. [provided by RefSeq]

Sequence: INNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY

Specifications

Accession Number	NP_005133.2
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	36.74kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	IF/IFMH/INF/TCN3
Gene Symbol	GIF
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	2694
Name	GIF (Human) Recombinant Protein (Q01)
Immunogen	INNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
Regulatory Status	RUO
Common Name	GIF
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ Human GIF Partial ORF (NP_005133.2, 318 a.a. - 417 a.a.) Recombinant Protein with GST-tag at N-terminal

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Abnova™ Human GIF Partial ORF (NP_005133.2, 318 a.a. - 417 a.a.) Recombinant Protein with GST-tag at N-terminal

Specifications

Description

Specifications

Documents