missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human FOXF2 Partial ORF (NP_001443.1, 346 a.a. - 443 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
2665.00 DKK - 4040.00 DKK
Specifications
Accession Number | NP_001443.1 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 2295 |
Molecular Weight (g/mol) | 36.52kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16138184
|
Abnova™
H00002295-Q01.25UG |
25 ug |
4040.00 DKK
25µg |
Estimated Shipment: 14-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16128184
|
Abnova™
H00002295-Q01.10UG |
10 ug |
2665.00 DKK
10µg |
Estimated Shipment: 14-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. [provided by RefSeq]
Sequence: SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCVSpecifications
NP_001443.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.52kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FKHL6/FREAC2 | |
FOXF2 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
2295 | |
FOXF2 (Human) Recombinant Protein (Q01) | |
SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV | |
RUO | |
FOXF2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |