Få mere at vide
Abnova™ Human FBXO7 Partial ORF (NP_036311, 357 a.a. - 455 a.a.) Recombinant Protein with GST-tag at N-terminal
Beskrivelse
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and it may play a role in regulation of hematopoiesis. Alternatively spliced transcript variants of this gene have been identified with the full-length natures of only some variants being determined. [provided by RefSeq]
Tekniske data
Tekniske data
| Adgangsnummer | NP_036311 |
| Til brug med (applikation) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulering | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-id (Entrez) | 25793 |
| Molekylvægt (g/mol) | 36.63kDa |
| Navn | FBXO7 (Human) Recombinant Protein (Q01) |
| Kvalitetskontrol test | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Mængde | 10 μg |
| Immunogen | AVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLP |
| Opbevaringskrav | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Vis mere |
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.