missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. 30194453

Invitrogen™ Human ESRP1 (aa 23-102) Control Fragment Recombinant Protein

Artikelnummer. 30194453
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30194453

Brand: Invitrogen™ RP105415

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84744 (PA5-84744. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RBM35A, also known as ESRP1, is a mRNA splicing factor that with its related protein RBM35B (ESRP2) are coordinators of an epithelial cell-type-specific splicing program. RBM35A contains three putative RNA recognition motifs and acts by directly binding specific sequences in mRNAs. RBM35A is involved in posttranscriptional regulation of a number of genes such as FGFR2, CD44, CTNND1, and ENAH by exerting a differential effect on protein translation via 5' UTRs of mRNAs. Other recent studies have shown that RMB35A may also act as a novel tumor suppressor.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q6NXG1
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 54845
Navn Human ESRP1 (aa 23-102) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias 2210008M09Rik; A630065D16; BC031468; epithelial splicing regulatory protein 1; Esrp1; Rbm35a; RGD1560481; RMB35A; RNA binding motif protein 35 A; RNA-binding motif protein 35 A; RNA-binding protein 35 A
Fælles navn ESRP1
Gen symbol ESRP1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens LGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGVGT
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.