missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ENOX1 (aa 465-559) Control Fragment Recombinant Protein

Recombinant Protein

Brand: Invitrogen™ RP97924

Product Code. 30180779

2020.00 DKK / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58355 (PA5-58355. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probably acts as a terminal oxidase of plasma electron transport from cytosolic NAD(P)H via hydroquinones to acceptors at the cell surface. Hydroquinone oxidase activity alternates with a protein disulfide-thiol interchange/oxidoreductase activity which may control physical membrane displacements associated with vesicle budding or cell enlargement. The activities oscillate with a period length of 24 minutes and play a role in control of the ultradian cellular biological clock.

Specifications

Accession Number	Q8TC92
For Use With (Application)	Blocking Assay, Control
Gene ID (Entrez)	55068
Quantity	100 μL
Gene Alias	bA64J21.1; candidate growth-related and time keeping constitutive hydroquinone (NADH) oxidase; candidate growth-related and time keeping constitutive hydroquinone [NADH] oxidase; cCNOX; Cell proliferation-inducing gene 38 protein; CNOX; Constitutive Ecto-NOX; ecto-NOX disulfide-thiol exchanger 1; ENO x 1; Hydroquinone [NADH] oxidase; PIG38; Protein disulfide-thiol oxidoreductase
Gene Symbol	ENOX1
Species	Human
Protein Tag	His-ABP-tag
Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Form	Liquid

Concentration	≥5.0 mg/mL
Formulation	1 M urea, PBS with no preservative; pH 7.4
Name	Human ENOX1 (aa 465-559) Control Fragment
Regulatory Status	RUO
Common Name	ENOX1
Conjugate	Unconjugated
Recombinant	Recombinant
Sequence	TKDQQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQDRENNIEKRS
Expression System	E. coli
Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Invitrogen™ Human ENOX1 (aa 465-559) Control Fragment Recombinant Protein > 100 μL; Unlabeled

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Invitrogen™ Human ENOX1 (aa 465-559) Control Fragment Recombinant Protein

Description

Specifications

Product Suggestions

Documents

Promotions