missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human EFHD1 Partial ORF (NP_079478.1, 168 a.a. - 238 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00080303-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
EFHD1 is an EF-hand domain-containing protein that displays increased expression during neuronal differentiation (Tominaga and Tomooka, 2002 [PubMed 12270117]).[supplied by OMIM]
Sequence: GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFNSpecifications
| NP_079478.1 | |
| Liquid | |
| 80303 | |
| EFHD1 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DKFZp781H0842/FLJ13612/MST133/MSTP133/PP3051 | |
| EFHD1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.44kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN | |
| RUO | |
| EFHD1 | |
| Wheat Germ (in vitro) | |
| GST |