missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human DNMT1 (aa 766-911) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP101879
This item is not returnable.
View return policy
Description
Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a subunit of the augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. The encoded protein was identified by interaction with ubiquitin C-terminal hydrolase 37. Alternative splicing results in multiple transcript variants.
Specifications
| P26358 | |
| Blocking Assay, Control | |
| 1786 | |
| 100 ÎĽL | |
| ADCADN; AIM; CXXC9; CXXC-type zinc finger protein 9; DNA (cytosine-5-)-methyltransferase 1; DNA (cytosine-5)-methyltransferase 1; DNA methyltransferase (cytosine-5) 1; DNA methyltransferase 1; DNA methyltransferase HsaI; DNA methyltransferase I; DNA methyltransferase MmuI; DNA MTase HsaI; DNA MTase MmuI; DNA MTase RnoIP; DNMT; Dnmt1; Dnmt1o; FLJ16293; HSN1E; m.HsaI; m.MmuI; m.RnoIP; MCMT; Met1; Met-1; MGC104992; MommeD2; MTase; Uim | |
| DNMT1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human DNMT1 (aa 766-911) Control Fragment | |
| RUO | |
| DNMT1 | |
| Unconjugated | |
| Recombinant | |
| IPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Invitrogen™ Human DNMT1 (aa 766-911) Control Fragment Recombinant Protein > 100 μL; Unlabeled
Spot an opportunity for improvement?Share a Content Correction