Learn More
Invitrogen™ Human Cystatin B (aa 22-96) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP91781
Description
Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110828 (PA5-110828. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Cystatin A (also designated STF1, STFA, stefin A or cystatin AS) and cystatin B (also designated PME, CST6, STFB, CPI-B, stefin B and liver thiol proteinase inhibitor) are thiol protease inhibitors that form complexes with Papain and the cathepsins B, H and L. Cystatin A, a cytoplasmic protein, is one of the precursor proteins of the cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Cystatin B protects against intracellular proteases leaking out of lysosomes and is primarily expressed in heart, liver and kidney.
Specifications
P04080 | |
Blocking Assay, Control | |
1476 | |
100 ÎĽL | |
AA960480; CPI-B; Cst6; CSTB; Cyb; cystatin B; cystatin B (stefin B); cystatin B protein; cystatin beta; cystatin-B; Cystatin-beta; Epm1; EPM1A; Liver thiol proteinase inhibitor; LOC101123010; PME; stefin B; Stefin-B; stefin-C; Stfb; ULD; Unknown (protein for MGC:134609) | |
CSTB | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Cystatin B (aa 22-96) Control Fragment | |
RUO | |
Cystatin B | |
Unconjugated | |
Recombinant | |
QVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELT | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.