Learn More
Abnova™ Human CXCR3 Partial ORF (NP_001495.1, 1 a.a. - 53 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00002833-Q02.25ug
Additional Details : Weight : 0.02000kg
Description
This gene encodes a G pr-coupled receptor with selectivity for 3 chemokines, termed IP10, Mig and I-TAC. IP10, Mig and I-TAC belong to the structural subfamily of CXC chemokines, in which a single aa residue separates first 2 of 4 highly conserved Cys residues. Binding of chemokines to this pr induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Inhibition by Bordetella pertussis toxin suggests that heterotrimeric G pr of the Gi-subclass couple to this protein. Signal transduction may include same enzymes that were identified in the signaling cascade induced by other chemokine receptors. As a consequence of chemokine-induced cellular desensitization, cellular responses are typically rapid and short in duration. Cellular responsiveness is restored after dephosphorylation of intracellular receptors and subsequent recycling to cell surface. This gene is prominently expressed in in vitro cultured effector/memory T cells, and in T cells present in many types of inflamed tissues. In addition, IP10, Mig and I-TAC are commonly produced by local cells in inflammatory lesion, suggesting that this gene and its chemokines participate in recruitment of inflammatory cells. So, this protein is a target for development of small M.W. antagonists, which may be used in treatment of diverse inflammatory diseases. Multiple transcript variants encoding different isoforms have been found for this gene.
Sequence: MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRSpecifications
NP_001495.1 | |
Liquid | |
2833 | |
CXCR3 (Human) Recombinant Protein (Q02) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CD182/CD183/CKR-L2/CMKAR3/GPR9/IP10-R/Mig-R/MigR | |
CXCR3 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
31.57kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR | |
RUO | |
CXCR3 | |
Wheat Germ (in vitro) | |
GST |