missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human CTSW Control Fragment Recombinant Protein

Artikelnummer. 30197393
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30197393

Brand: Invitrogen™ RP110047

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144943 (PA5-144943. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cathepsin W (lymphopain) and cathepsin F comprise a novel subgroup of cathepsin proteases, and are phylogenetically distinct from other human cathepsins. The cathepsin W gene maps to chromosome 11q13.1 and contains ten exons with introns ranging from 81-119 bp. Cathepsin W protein is expressed specifically in CD8+ T lymphocytes. The expression of cathepsin W first occurs during the differentiation of thyrocytes to CD8+ T lymphocytes, just as the thymocytes cease expression of CD4+ receptors. In transfected Cos-7 and HeLa cells, cathepsin W localizes within the rough endoplasmic reticulum. Cathepsin W contains a unique 21 amino acid peptide insertion between the active site histidine and asparagine residues, in addition to a distictive 8-amino acid carboxy-terminal extension. An extended loop struc-ture in the second or beta-sheet domain and an additional disulfide bind are two of several signature features of cathepsin W. Other features of cathepsin W include an additional cysteine, an S2 pocket and an additional residue. Cathepsin W may exist as a dimer with each monomer forming a disulfide bond.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer P56202
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 1521
Navn Human CTSW Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias Cathepsin W; Ctsw; lymphopain; LYPN
Fælles navn CTSW
Gen symbol CTSW
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens EEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGNIETLWRISFWD
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.