missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human COQ2 Partial ORF (NP_056512.3, 84 a.a. - 132 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00027235-Q01.10ug
Additional Details : Weight : 0.02000kg
Description
CoQ (ubiquinone) serves as a redox carrier in the mitochondrial respiratory chain and is a lipid-soluble antioxidant. COQ2, or parahydroxybenzoate-polyprenyltransferase (EC 2.5.1.39), catalyzes one of the final reactions in the biosynthesis of CoQ, the prenylation of parahydroxybenzoate with an all-trans polyprenyl group (Forsgren et al., 2004 [PubMed 15153069]).[supplied by OMIM]
Sequence: AAGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRPLQPYLRLMRLDKSpecifications
| NP_056512.3 | |
| Liquid | |
| 27235 | |
| COQ2 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CL640/FLJ26072 | |
| COQ2 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.13kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| AAGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRPLQPYLRLMRLDK | |
| RUO | |
| COQ2 | |
| Wheat Germ (in vitro) | |
| GST |