missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human COQ2 Partial ORF (NP_056512.3, 84 a.a. - 132 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00027235-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16075415

  • 2665.00 DKK / 10µg
Estimated Shipment: 13-08-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

CoQ (ubiquinone) serves as a redox carrier in the mitochondrial respiratory chain and is a lipid-soluble antioxidant. COQ2, or parahydroxybenzoate-polyprenyltransferase (EC 2.5.1.39), catalyzes one of the final reactions in the biosynthesis of CoQ, the prenylation of parahydroxybenzoate with an all-trans polyprenyl group (Forsgren et al., 2004 [PubMed 15153069]).[supplied by OMIM]

Sequence: AAGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRPLQPYLRLMRLDK
Specifications

Specifications

NP_056512.3
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.13kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AAGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRPLQPYLRLMRLDK
RUO
COQ2
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
27235
COQ2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CL640/FLJ26072
COQ2
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers