Learn More
Invitrogen™ Human CLEC2A (aa 74-103) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP99996
Description
Highest antigen sequence indentity to the following orthologs: Mouse (43%), Rat (43%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61762 (PA5-61762. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
CLEC2A (C-type lectin domain family 2 member A), also known as PILAR (proliferation-induced lymphocyte-associated receptor) is involved in modulating T-cell expansion. It is a 32 kDa single-pass type II membrane protein that contains one C-type lectin domain in its extracellular region and belongs to the CTL/CTLD superfamily. CLEC2A is mainly expressed in skin and highly expressed in CD8(+), B lymphocytes and naive CD4(+) T cells. Manipulation of CLEC2A signaling may be important for treatment of autoimmune diseases and cancer.
Specifications
Q6UVW9 | |
Blocking Assay, Control | |
387836 | |
100 ÎĽL | |
CLEC2A; C-type lectin domain family 2 member A; C-type lectin domain family 2, member A; INPE5792; KACL; Keratinocyte-associated C-type lectin; PILAR; Proliferation-induced lymphocyte-associated receptor; UNQ579; UNQ5792; UNQ5792/PRO19597 | |
CLEC2A | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CLEC2A (aa 74-103) Control Fragment | |
RUO | |
CLEC2A | |
Unconjugated | |
Recombinant | |
DDTRNWTASKIFCSLQKAELAQIDTQEDME | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.