missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human cGAS Control Fragment Recombinant Protein

Artikelnummer. 30200414
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30200414

Brand: Invitrogen™ RP110183

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

cGAS (Cyclic GMP-AMP synthase) is a nucleotidyltransferase that catalyzes the formation of cyclic GMP-AMP (cGAMP) from ATP and GTP and plays a key role in innate immunity. Catalysis involves both the formation of 2', 5' phosphodiester linkage at the GpA step and the formation of 3', 5' phosphodiester linkage at the ApG step. This produces c[G(2',5')pA(3'5')p] responses. cGAS also binds cytosolic DNA directly, leading to the activation and synthesis of cGAMP. Then, a second messenger binds to and activates TMEM173/STING thereby triggering type-I interferon production. cGAS is also involved in innate immune sensorship of infection, detection of DNA from bacteria, response to cellular stress, DNA damage, and regulation of cellular senescence.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q8N884
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 115004
Navn Human cGAS Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias C6orf150; h-cGAS; MB21D1
Fælles navn cGAS
Gen symbol CGAS
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens SNTRAYYFVKFKRNPKENHLSQFLEGEILSASKMLSKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEKISVDITLALE
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.