missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human CDK11A (aa 688-765) Control Fragment Recombinant Protein

Artikelnummer. 30207755
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30207755

Brand: Invitrogen™ RP105663

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84929 (PA5-84929. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The PITSLRE beta1 protein, a distantly related member of the Cdk family of protein kinases, induces apoptosis after low levels of ectopic expression. Apoptosis, or programmed cell death, is similarly induced by ectopic expression of an amino terminal deletion mutant retaining the catalytic and carboxyterminal domains of PITSLRE beta1, but not by other mutants lacking Histone H1 kinase activity or by other Cdk family members. The terminology for the ten isoforms of the PITSLRE subfamily of proteins is based on the conserved PSTAIRE box region of Cdc2 p34. Depending on which of the PITSLRE genes produce the protein, the cDNA and protein are designated alpha, beta or gamma (i.e., PITSLRE A gene, alpha; PITSLRE B gene, beta and PITSLRE C gene, gamma). Some of the isoforms such as PITSLRE alpha1 (T cells) and PITSLRE beta1 (B cells and brain), are expressed in specific cell types, while others are expressed ubiquitously.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q9UQ88
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 728642
Navn Human CDK11A (aa 688-765) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias CDC2L2; CDC2L3; CDK11 p110; CDK11 p46; CDK11 p58; CDK11A; CDK11-p110; CDK11-p46; CDK11-p58; cell division cycle 2-like 2 (PITSLRE proteins); cell division cycle 2-like protein kinase 2; Cell division protein kinase 11 A; cyclin dependent kinase 11 A; cyclin-dependent kinase 11 A; Galactosyltransferase-associated protein kinase p58/GTA; p58GTA; PITSLRE; PITSLRE B; PITSLRE protein kinase beta; PITSLRE serine/threonine-protein kinase CDC2L2; PITSLREB
Fælles navn CDK11A
Gen symbol CDK11A
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens MNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHL
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.