missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. 30196979

Invitrogen™ Human Carbonic Anhydrase XII (aa 159-278) Control Fragment Recombinant Protein

Artikelnummer. 30196979
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
30196979 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30196979 Leverandør Invitrogen™ Leverandørnr. RP89981

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52608 (PA5-52608. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Carbonic Anhydrase XII is a protein coding gene.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer O43570
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 771
Navn Human Carbonic Anhydrase XII (aa 159-278) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias 2310047E01Rik; AI314958; CA12; Car12; Carbonate dehydratase XII; carbonic anhydrase 12; Carbonic anhydrase XII; carbonic anyhydrase 12; carbonic dehydratase; CAXII; CA-XII; HsT18816; membrane-bound carbonic anhydrase 12; T18816; tumor antigen HOM-RCC-3.1.3
Fælles navn Carbonic Anhydrase XII
Gen symbol CA12
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.