missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. 30211770

Invitrogen™ Human Calpain 11 (aa 547-629) Control Fragment Recombinant Protein

Artikelnummer. 30211770
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30211770

Brand: Invitrogen™ RP94868

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83168 (PA5-83168. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The calpains including Calpain 1 (CAPN1), calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene. Diseases associated with CAPN1 include Spastic Paraplegia 76, Autosomal Recessive and Spasticity.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q9UMQ6
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 11131
Navn Human Calpain 11 (aa 547-629) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias calcium-activated neutral proteinase 11; calcium-activated neutral proteinase 11 {ECO:0000250; calcium-dependent thiol protease; calpain 11; calpain 11 {ECO:0000312; calpain11; Calpain-11; calpain-11; LOW QUALITY PROTEIN: calpain-11; CANP 11; CANP 11 {ECO:0000250; Capn11; capn11 {ECO:0000312; EMBL:AAH97256.1}; HIP2; LIG; RGD:1302946}; UniProtKB:Q9UMQ6}
Fælles navn Calpain 11
Gen symbol CAPN11
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens WELDEVNYAEQLQEEKVSEDDMDQDFLHLFKIVAGEGKEIGVYELQRLLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGK
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.