missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human C19orf37 Full-length ORF (NP_872304.2, 1 a.a. - 188 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00126299-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137713

  • 4040.00 DKK / 25µg
Estimated Shipment: 23-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MTETREPAETGGYASLEEDDEDLSPGPEHSSDSEYTLSEPDSEEEEDEEEEEEETTDDPEYDPGYKVKQRLGGGRGGPSRRAPRAAQPPAQPCQLCGRSPLGEAPPGTPPCRLCCPATAPQEAPAPEGRALGEEEEEPPRAGEGRPAGREEEEEEEEEGTYHCTECEDSFDNLGELHGHFMLHARGEV
Specifications

Specifications

NP_872304.2
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
46.9kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C19orf37/MGC51082/Zfp428
ZNF428
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
126299
C19orf37 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MTETREPAETGGYASLEEDDEDLSPGPEHSSDSEYTLSEPDSEEEEDEEEEEEETTDDPEYDPGYKVKQRLGGGRGGPSRRAPRAAQPPAQPCQLCGRSPLGEAPPGTPPCRLCCPATAPQEAPAPEGRALGEEEEEPPRAGEGRPAGREEEEEEEEEGTYHCTECEDSFDNLGELHGHFMLHARGEV
RUO
ZNF428
Wheat Germ (in vitro)
GST
Liquid
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers