missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BMP2 Partial ORF (NP_001191, 231 a.a. - 330 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

2665.00 DKK - 4040.00 DKK

Specifications

Accession Number NP_001191
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 650
Molecular Weight (g/mol) 36.74kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16053665
View Documents Promotion Details
Abnova™
H00000650-Q03.25UG
25 ug
4040.00 DKK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 15-08-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16043665
View Documents Promotion Details
Abnova™
H00000650-Q03.10UG
10 ug
2665.00 DKK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 15-08-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily. The encoded protein acts as a disulfide-linked homodimer and induces bone and cartilage formation. [provided by RefSeq]

Sequence: AHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECP
Specifications

Specifications

NP_001191
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BMP2A
BMP2
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
650
BMP2 (Human) Recombinant Protein (Q03)
AHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECP
RUO
BMP2
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Product Certifications