missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AXIN1 Partial ORF (NP_003493, 643 a.a. - 740 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00008312-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16074985

  • 2665.00 DKK / 10µg
Estimated Shipment: 19-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a dishevelled and axin (DIX) domain. The encoded protein interacts with adenomatosis polyposis coli, catenin (cadherin-associated protein), beta 1, 88kDa, glycogen synthase kinase 3 beta, protein phosphate 2, and itself. This protein functions as a negative regulator of the wingless-type MMTV integration site family, member 1 (WNT) signaling pathway and can induce apoptosis. The crystal structure of a portion of this protein, alone and in a complex with other proteins, has been resolved. Mutations in this gene have been associated with hepatocellular carcinoma, hepatoblastomas, ovarian endometriod adenocarcinomas, and medullablastomas. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Sequence: ISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRA
Specifications

Specifications

NP_003493
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRA
RUO
AXIN1
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
8312
AXIN1 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AXIN/MGC52315
AXIN1
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers