missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human ATP6V1B1 (aa 1-66) Control Fragment Recombinant Protein

Artikelnummer. 30213206
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30213206

Brand: Invitrogen™ RP96039

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56878 (PA5-56878. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Vacuolar-type H+-ATPase (V-ATPase) is a multisubunit enzyme responsible for acidification of eukaryotic intracellular organelles. V-ATPases pump protons against an electrochemical gradient, while F-ATPases reverse the process, thereby synthesizing ATP. A peripheral V1 domain, which is responsible for ATP hydrolysis, and a integral V0 domain, which is responsible for proton translocation, compose V-ATPase. Nine subunits (A-H) make up the V1 domain and five subunits (a, d, c, c' and c') make up the V0 domain. Like F-ATPase, V-ATPase most likely operates through a rotary mechanism. The V-ATPase V1 B subunit exists as two isoforms. In the inner ear, the V-ATPase B1 isoform functions in proton secretion and is required to maintain proper endolymph pH and normal auditory function. The gene encoding the human V-ATPase B1 isoform maps to chromosome 2cen-q13. Mutations in this gene cause distal renal tubular acidosis associated with sensorineural deafness. The V-ATPase B2 isoform is expressed in kidney and is the only B isoform expressed in osteoclasts.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer P15313
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 525
Navn Human ATP6V1B1 (aa 1-66) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias ATP6B1; ATP6V1B1; ATPase H+ transporting V1 subunit B1; ATPase, H transporting, lysosomal V1 subunit B1; ATPase, H+ transporting, lysosomal (vacuolar proton pump), beta 56/58 kDa, isoform 1; ATPase, H+ transporting, lysosomal 56/58 kDa, V1 subunit B, isoform 1; ATPase, H+ transporting, lysosomal 56/58 kDa, V1 subunit B1; ATPase, H+ transporting, lysosomal 56/58 kDa, V1 subunit B1 (Renal tubular acidosis with deafness); ATPase, H+ transporting, lysosomal V1 subunit B1; ATPase, H+ transporting, V1 subunit B, isoform 1; AW208839; D630003L15; D630030L16Rik; D630039P21Rik; endomembrane proton pump 58 kDa subunit; H(+)-transporting two-sector ATPase, 58 kD subunit; H+-ATPase beta 1 subunit; lysosomal 56/58 kDa; RTA1B; vacuolar H+-ATPase; vacuolar proton pump 3; vacuolar proton pump subunit B 1; vacuolar proton pump, subunit 3; VATB; V-ATPase B1; V-ATPase B1 subunit; V-ATPase subunit B 1; VMA2; VPP3; Vpp-3; V-type proton ATPase subunit B, kidney isoform
Fælles navn V-ATPase B1
Gen symbol Atp6v1b1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIV
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.