missing translation for 'onlineSavingsMsg'
Få mere at vide

Invitrogen™ Human ATP6V0A1 (aa 35-129) Control Fragment Recombinant Protein

Artikelnummer. 30194617
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30194617

Brand: Invitrogen™ RP93230

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54570 (PA5-54570. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP6V0A1 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three A subunit proteins and the encoded protein is associated with clathrin-coated vesicles.
TRUSTED_SUSTAINABILITY

Tekniske data

Adgangsnummer Q93050
Koncentration ≥5.0 mg/mL
Til brug med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-id (Entrez) 535
Navn Human ATP6V0A1 (aa 35-129) Control Fragment
Mængde 100 μL
Regulatorisk status RUO
Gene Alias a1; AA959968; adenosine triphosphatase; ATP6a1; ATP6N1; ATP6N1A; Atp6v0a1; ATPase H+ transporting lysosomal (vacuolar proton pump) noncatalytic accessory protein 1 (110/160 kDa); ATPase H+ transporting V0 subunit a1; ATPase, H+ transporting, lysosomal (vacuolar proton pump) noncatalytic accessory protein 1 (110/160 kDa); ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 1 A (110/116 kD); ATPase, H+ transporting, lysosomal (vacuolar proton pump) noncatalytic accessory protein 1 A (110/160 kDa); ATPase, H+ transporting, lysosomal non-catalytic accessory protein 1 (110/116 kD); ATPase, H+ transporting, lysosomal noncatalytic accessory protein 1 A; ATPase, H+ transporting, lysosomal V0 subunit a; ATPase, H+ transporting, lysosomal V0 subunit a1; Atpv0a1; Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit; H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1; Stv1; V-A; vacuolar adenosine triphosphatase subunit Ac116; vacuolar H+-ATPase subunit; vacuolar proton pump subunit 1; vacuolar proton translocating ATPase 116 kDa subunit A; Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1; vacuolar proton-translocating ATPase a1 isoform; vacuolar-type H(+)-ATPase 115 kDa subunit; V-ATPase 116 kDa; V-ATPase 116 kDa isoform a1; V-ATPase 116 kDa subunit; V-ATPase 116 kDa subunit a1; V-ATPase a1; v-H+ATPase subunit a1; Vph1; Vpp1; Vpp-1; V-type proton ATPase 116 kDa subunit a; V-type proton ATPase 116 kDa subunit a isoform 1; V-type proton ATPase 116 kDa subunit a isoform 1; V-type proton ATPase 116 kDa subunit a; V-type proton ATPase 116 kDa subunit a1
Fælles navn ATP6V0A1
Gen symbol ATP6V0A1
Konjugeret Unconjugated
Arter Human
Rekombinant Recombinant
Protein tag His-ABP-tag
Sekvens VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELK
Indhold og opbevaring -20°C, Avoid Freeze/Thaw Cycles
Udtrykssystem E. coli
Form Liquid
Renhed eller kvalitetsklasse >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.