missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ALPK1 Partial ORF (NP_079420.2, 1147 a.a. - 1242 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00080216-Q01.25ug

View more versions of this product

Product Code. 16130217

4145.00 DKK / 25µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Unlike most eukaryotic kinases, alpha kinases, such as LAK, recognize phosphorylation sites in which the surrounding peptides have an alpha-helical conformation.[supplied by OMIM]

Sequence: VVKTEYKATEYGLAYGHFSYEFSNHRDVVVDLQGWVTGNGKGLIYLTDPQIHSVDQKVFTTNFGKRGIFYFFNNQHVECNEICHRLSLTRPSMEKP

Specifications

Accession Number	NP_079420.2
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	36.3kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	VVKTEYKATEYGLAYGHFSYEFSNHRDVVVDLQGWVTGNGKGLIYLTDPQIHSVDQKVFTTNFGKRGIFYFFNNQHVECNEICHRLSLTRPSMEKP
Regulatory Status	RUO
Common Name	ALPK1
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	80216
Name	ALPK1 (Human) Recombinant Protein (Q01)
Quantity	25 μg
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	8430410J10Rik/FLJ22670/KIAA1527/LAK
Gene Symbol	ALPK1
Recombinant	Recombinant
Expression System	wheat germ expression system

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ Human ALPK1 Partial ORF (NP_079420.2, 1147 a.a. - 1242 a.a.) Recombinant Protein with GST-tag at N-terminal > 25μg

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Abnova™ Human ALPK1 Partial ORF (NP_079420.2, 1147 a.a. - 1242 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Product Suggestions

Documents

Promotions