missing translation for 'onlineSavingsMsg'
Få mere at vide

Abnova™ HOXB13 (Human) Recombinant Protein

Artikelnummer. p-7164673
Klik for at se tilgængelige muligheder
Mængde:
10 μg
25 μg
Pakningsstørrelse:
25µg
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 16125182

Brand: Abnova™ H00010481Q01.10ug

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Human HOXB13 partial ORF (AAH07092.1, 61 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: KQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEYPSRPTEFAFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRRG

Tekniske data

Adgangsnummer AAH07092.1
Gen-id (Entrez) 10481
Navn homeobox B13
Fremstillingsmetode Wheat germ expression system
Kvalitetskontrol test 125% SDS-PAGE Stained with Coomassie Blue
Mængde 10 μg
Opbevaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias PSGD
Gen symbol HOXB13
Arter Wheat Germ (in vitro)
Protein tag GST
Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.