missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. HNRPA3 Antibody, R&D Systems™

HNRPA3 Antibody, R&D Systems™

Artikelnummer. 18601788 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18601788 25 μL
18232805 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18601788 Leverandør Novus Biologicals Leverandørnr. NBP25698925ul
 Begrænset vare
Forventet forsendelse: 02-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

HNRPA3 Polyclonal specifically detects HNRPA3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Western Blot.
TRUSTED_SUSTAINABILITY

Specifica

Antigen HNRPA3
Applikationer Western Blot, Immunocytochemistry, Immunofluorescence
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulering PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias heterogeneous nuclear ribonucleoprotein A3
Gensymboler HNRNPA3
Værtsarter Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQL
Oprensningsmetode Affinity Purified
Mængde 25 μL
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 220988
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Indhold og opbevaring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Produkttype Antibody
Form Purified
Isotype IgG
Produktlinje Novus
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.