missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
HIV-1 Gag p24 Antibody, Alexa Fluor™ 750, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-41214AF750
3812.25 DKK valid until 2025-12-16
BEDSTE tilbudspris! Brug kampagnekoden "24090" for at få din tilbudspris.
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
HIV-1 Gag p24 Polyclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA
Tekniske data
| HIV-1 Gag p24 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein . Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla | |
| 0.1 mL | |
| Infections (Virus Bacteria and Parasites) | |
| 155030 | |
| Store at 4°C in the dark. | |
| IgG |
| Western Blot, ELISA | |
| Alexa Fluor 750 | |
| Rabbit | |
| Peptide affinity purified | |
| RUO | |
| Primary | |
| Virus | |
| Purified |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion