missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
HIV-1 Gag p24 Antibody (7F4), Alexa Fluor™ 750, Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-41339AF750
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
HIV-1 Gag p24 Monoclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA
Tekniske data
| HIV-1 Gag p24 | |
| Monoclonal | |
| Alexa Fluor 750 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Virus | |
| Purified |
| Western Blot, ELISA | |
| 7F4 | |
| 50mM Sodium Borate | |
| Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla | |
| 0.1 mL | |
| Infections (Virus Bacteria and Parasites) | |
| 155030 | |
| Store at 4°C in the dark. | |
| IgG1 |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion