missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ HIST1H2BN Recombinant Protein
Brand: Abnova™ H00008341-P01.25ug
This item is not returnable.
View return policy
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
| AAH11372 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 44 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 μg | |
| MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKKRKRRFTESIKKAHGFRKLKIWLKLRVSNQSPDDIYIARD | |
| H2B/d/H2BFD/HIST1H3I/MGC125414/MGC125415/MGC125416/MGC9388 | |
| HIST1H2BN | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 8341 | |
| HIST1H2BN (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| HIST1H2BN | |
| Human | |
| Recombinant | |
| Solution |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ HIST1H2BN Recombinant Protein > 25μg
Spot an opportunity for improvement?Share a Content Correction