missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Biokemiske reagenser
  4. Peptider
  5. 18374450

Novus Biologicals™ GPT Recombinant Protein Antigen

Artikelnummer. 18374450 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0,1 ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18374450 0,1 ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18374450 Leverandør Novus Biologicals™ Leverandørnr. NBP189111PEP

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPT. The GPT Recombinant Protein Antigen is derived from E. coli. The GPT Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-89111. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Tekniske data

Gen-id (Entrez) 2875
Arter Human
Oprensningsmetode Chromatography
Renhed >80%
Koncentration 0.5mg/mL
Indhold og opbevaring Store at -20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
Til brug med (applikation) Blocking/Neutralizing, Control
Gene Alias AAT1alanine aminotransferase 1, ALT1, ALT1EC 2.6.1.2, Glutamate pyruvate transaminase 1, glutamic-alanine transaminase 1, Glutamic--alanine transaminase 1, glutamic-pyruvate transaminase (alanine aminotransferase), Glutamic--pyruvic transaminase 1, GPT1GPT 1
Gen symbol GPT
Etikettype Unlabeled
Molekylvægt (g/mol) 24kDa
Produkttype GPT
Mængde 0,1 ml
Regulatorisk status RUO
Forskningskategori metabolism
Kilde E.Coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89111. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFT
Vis mere Vis mindre

For Research Use Only

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.