missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Novus Biologicals™ Glutamate Dehydrogenase Recombinant Protein Antigen
Shop alle Bio Techne produkterBeskrivelse
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Glutamate Dehydrogenase The Glutamate Dehydrogenase Recombinant Protein Antigen is derived from E. coli. The Glutamate Dehydrogenase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Tekniske data
Tekniske data
| Gen-id (Entrez) | 2746 |
| Protein længde | KPCNHVLSLSFPIRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKN |
| Oprensningsmetode | >80% by SDS-PAGE and Coomassie blue staining |
| Fælles navn | GLUD1 Recombinant Protein Antigen |
| Indhold og opbevaring | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulering | PBS and 1M Urea, pH 7.4 |
| Til brug med (applikation) | Blocking/Neutralizing, Control |
| Gene Alias | EC 1.4.1, EC 1.4.1.3, GDH 1, GDH, GDH1, GLUD |
| Gen symbol | GLUD1 |
| Etikettype | Unlabeled |
| Vis mere |
For Research Use Only.
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?