missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498628

GADD45G Antibody [Alexa Fluor« 488], R&D Systems™

Artikelnummer. 30498628 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
30498628 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498628 Leverandør Novus Biologicals Leverandørnr. NBP335120AF488
 Begrænset vare
Forventet forsendelse: 12-10-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

GADD45G Polyclonal antibody specifically detects GADD45G in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen GADD45G
Applikationer ELISA, Western Blot
Klassifikation Polyclonal
Konjugeret Alexa Fluor 488
Formulering 50mM Sodium Borate
Gene Alias CR6DNA damage-inducible transcript 2 protein, Cytokine-responsive protein CR6, DDIT-2, DDIT2GADD45-gamma, growth arrest and DNA damage-inducible protein GADD45 gamma, growth arrest and DNA-damage-inducible, gamma, GRP1717 kD
Værtsarter Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 90-159 of human GADD45G (NP_006696.1).,, Sequence:, IDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Apoptosis, Cancer
Primær eller sekundær Primary
Gen-id (Entrez) 10912
Målarter Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.