missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. FABP1/L-FABP Antibody, Novus Biologicals™

FABP1/L-FABP Antibody, Novus Biologicals™

Artikelnummer. 18022914 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
18022914 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18022914 Leverandør Novus Biologicals Leverandørnr. NBP187695

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody has been used in 2 publications

FABP1/L-FABP Polyclonal specifically detects FABP1/L-FABP in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen FABP1/L-FABP
Applikationer Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias FABPL, fatty acid binding protein 1, liver, fatty acid-binding protein, liver, L-FABPFatty acid-binding protein 1, Liver-type fatty acid-binding protein
Gensymboler FABP1
Værtsarter Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Oprensningsmetode Affinity Purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Breast Cancer, Cancer, Cholesterol Metabolism, Diabetes Research, Lipid and Metabolism
Primær eller sekundær Primary
Gen-id (Entrez) 2168
Testspecificitet Specificity of human FABP1/L-FABP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vis mere Vis mindre

For Research Use Only

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.