missing translation for 'onlineSavingsMsg'
Learn More

ERMP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17585-25UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18310925

  • 2756.95 DKK / 25µL
Estimated Shipment: 27-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ERMP1 Polyclonal antibody specifically detects ERMP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

ERMP1
Polyclonal
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
endoplasmic reticulum metallopeptidase 1, plant and worm proteins)
This antibody was developed against Recombinant Protein corresponding to amino acids: LGLALYLIALRTLVQLSLQQLVLRGAAGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVDVQRPTGSFSIDFLGGFTSYYDNITNVVVKLEPRDGAQHAVLAN
25 μg
Primary
Human
Purified
Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
79956
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers