missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. ERK5/BMK1 Antibody, R&D Systems™

ERK5/BMK1 Antibody, R&D Systems™

Artikelnummer. 18606286 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18606286 25 μL
18286411 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18606286 Leverandør Novus Biologicals Leverandørnr. NBP25836925ul
 Begrænset vare
Forventet forsendelse: 01-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

ERK5/BMK1 Polyclonal specifically detects ERK5/BMK1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen ERK5/BMK1
Applikationer Immunocytochemistry, Immunofluorescence
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulering PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias Big MAP kinase 1, BMK-1, BMK1 kinase, BMK1EC 2.7.11.24, EC 2.7.11, ERK-5, ERK5MAPK 7, Extracellular signal-regulated kinase 5, extracellular-signal-regulated kinase 5, MAP kinase 7, mitogen-activated protein kinase 7, PRKM7ERK4
Gensymboler MAPK7
Værtsarter Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMPSPWAPSGDCAMESPPPA
Oprensningsmetode Affinity Purified
Mængde 25 μL
Regulatorisk status RUO
Forskningsdisciplin Cell Cycle and Replication, Signal Transduction
Primær eller sekundær Primary
Gen-id (Entrez) 5598
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Indhold og opbevaring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Produkttype Antibody
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.